###################################################### ##### Sequences and other information for the C1 Domain ##### Prepared as a part of MeTaDoR (http://proteomics.bioengr.uic.edu/metador) ##### By Nitin Bhardwaj (Dr Hui Lu's Lab at the Univ of Illinois at Chicago) ##### As of May 2007 ###################################################### ###################################################### ##### README ##### First column contains the name of the host-protein ##### Second column contains the species name. 'Human', 'Yeast' and ##### 'Mouse' Have been indicated and others have been indicated by 'Others' ##### Third column indicates membrane-binding (indicated by 1) or ##### non-membrane-binding (indicated by 0) behavior of the protein. ##### Fourth and fifth columns state the function and subcellular location ##### of the protein as given in the Swiss-Prot/Uniprot database, respectively (wherever available). ##### Sixth and subsequent columns provide the sequences of all occurrence of ##### the domain in the host protein. ###################################################### MYO9B_HUMAN Human 1 FUNCTION: Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. May be involved in the remodeling of the actin cytoskeleton. Binds actin with high affinity both in the absence and presence of ATP and its mechanochemical activity is inhibited by calcium ions. Also acts as a GTPase activating protein on Rho. SUBCELLULAR LOCATION: In undifferentiated cells colocalizes with F-actin in the cell periphery while in differentiated cells its localiztion is cytoplasmic with the highest levels in the perinuclear region. GHVFASYQVSIPQSCEQCLSYIWLMDKALLCSVCKMTCHKKCVHKIQSHC MYO9B_MOUSE Mouse 1 FUNCTION: Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. May be involved in the remodeling of the actin cytoskeleton. Binds actin with high affinity both in the absence and presence of ATP and its mechanochemical activity is inhibited by calcium ions. Also acts as a GTPase activating protein on Rho. SUBCELLULAR LOCATION: In undifferentiated cells colocalizes with F-actin in the cell periphery while in differentiated cells its localiztion is cytoplasmic with the highest levels in the perinuclear region (By similarity). GHVFASYQVNIPQSCEQCLSYIWLMDKALLCSVCKMTCHKKCVHKIQSYC MYO9B_RAT Others 1 FUNCTION: Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. May be involved in the remodeling of the actin cytoskeleton. Binds actin with high affinity both in the absence and presence of ATP and its mechanochemical activity is inhibited by calcium ions. Also acts as a GTPase activating protein on Rho. SUBCELLULAR LOCATION: In undifferentiated cells colocalizes with F-actin in the cell periphery while in differentiated cells its localiztion is cytoplasmic with the highest levels in the perinuclear region (By similarity). GHVFASYQVNIPQSCEQCLSYIWLMDKALLCSVCKMTCHKKCVHKIQSYC CHIO_HUMAN Human 1 FUNCTION: GTPase-activating protein for p21-rac. Insufficient expression of beta-2 chimaerin is expected to lead to higher Rac activity and could therefore play a role in the progression from low-grade to high-grade tumors. SUBCELLULAR LOCATION: Membrane; peripheral membrane protein (Potential). THNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDC CHIO_MOUSE Mouse 1 FUNCTION: GTPase-activating protein for p21-rac (By similarity). SUBCELLULAR LOCATION: Membrane; peripheral membrane protein (Potential). THNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDC CHIO_RAT Others 1 FUNCTION: GTPase-activating protein for p21-rac. SUBCELLULAR LOCATION: Membrane; peripheral membrane protein (Potential). THNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDC DGKD_HUMAN Human 1 FUNCTION: May function as signaling molecule. Isoform 2 may be involved in cell growth and tumorigenesis. SUBCELLULAR LOCATION: Isoform 2: Cytoplasm. Isoform 1: Membrane; peripheral membrane protein. MHNWYACSHARPTYCNVCREALSGVTSHGLSCEVCKFKAHKRCAVRATNNC KPC1B_CAEEL Others 1 " FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." SUBCELLULAR LOCATION: Membrane; peripheral membrane protein. Associated with membranes and the cytoskeleton. GHKFMALFLRQPTFCAHCKEFIWGIGKQGYQCQICTVVVHKRCHEDVVWKC KPC2_APLCA Others 1 " FUNCTION: This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters (By similarity)." SUBCELLULAR LOCATION: Membrane; peripheral membrane protein. GHKFMAMFFRQPTFCSLCRDFIWGLGKQGYQCQVCTCVVHKRCHQHIVTKC KPCB_BOVIN Others 1 " FUNCTION: This is a calcium-activated, phospholipid-dependent, serine- and threonine-specific enzyme. PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters. May be considered as a novel component of the NF-kappa-B signaling axis responsible for the survival and activation of B-cells after BCR cross-linking (By similarity)." SUBCELLULAR LOCATION: Cytoplasm (By similarity). Membrane; peripheral membrane protein (By similarity). NHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSC KPCB_HUMAN Human 1 " FUNCTION: This is a calcium-activated, phospholipid-dependent, serine- and threonine-specific enzyme. PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters. May be considered as a novel component of the NF-kappa-B signaling axis responsible for the survival and activation of B-cells after BCR cross-linking (By similarity)." SUBCELLULAR LOCATION: Cytoplasm (By similarity). Membrane; peripheral membrane protein (By similarity). NHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSC KPCB_MOUSE Mouse 1 " FUNCTION: This is a calcium-activated, phospholipid-dependent, serine- and threonine-specific enzyme. PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters. May be considered as a novel component of the NF-kappa-B signaling axis responsible for the survival and activation of B-cells after BCR cross-linking." SUBCELLULAR LOCATION: Cytoplasm (By similarity). Membrane; peripheral membrane protein (By similarity). NHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSC KPCB_RABIT Others 1 " FUNCTION: This is a calcium-activated, phospholipid-dependent, serine- and threonine-specific enzyme. PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters. May be considered as a novel component of the NF-kappa-B signaling axis responsible for the survival and activation of B-cells after BCR cross-linking (By similarity)." SUBCELLULAR LOCATION: Cytoplasm (By similarity). Membrane; peripheral membrane protein (By similarity). NHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSC KPCB_RAT Others 1 " FUNCTION: This is a calcium-activated, phospholipid-dependent, serine- and threonine-specific enzyme. PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters. May be considered as a novel component of the NF-kappa-B signaling axis responsible for the survival and activation of B-cells after BCR cross-linking." SUBCELLULAR LOCATION: Cytoplasm. Membrane; peripheral membrane protein. NHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSC KPCD_CANFA Others 1 " FUNCTION: This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters. May play a role in antigen-dependent control of B-cell function (By similarity)." SUBCELLULAR LOCATION: Cytoplasm (By similarity). Membrane; peripheral membrane protein (By similarity). NHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRC KPCD_HUMAN Human 1 " FUNCTION: This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters. May play a role in antigen-dependent control of B-cell function." SUBCELLULAR LOCATION: Cytoplasm (By similarity). Membrane; peripheral membrane protein (By similarity). NHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRC KPCD_MOUSE Mouse 1 " FUNCTION: This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters. May play a role in antigen-dependent control of B-cell function." SUBCELLULAR LOCATION: Cytoplasm (By similarity). Membrane; peripheral membrane protein (By similarity). NHEFIATFFGQPTFCSVCKEFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRC KPCD_RAT Others 1 " FUNCTION: This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters. May play a role in antigen-dependent control of B-cell function. Truncated isoform 2 is inactive." SUBCELLULAR LOCATION: Cytoplasm. Membrane; peripheral membrane protein. NHEFIATFFGQPTFCSVCKEFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRC KSR1_HUMAN Human 1 " FUNCTION: Location-regulated scaffolding protein connecting MEK to RAF. Promotes MEK and RAF phosphorylation and activity through assembly of an activated signaling complex. By itself, it has no demonstrated kinase activity." " SUBCELLULAR LOCATION: Cytoplasm (By similarity). Membrane; peripheral membrane protein (By similarity). In unstimulated cells, where the phosphorylated form is bound to a 14-3-3 protein, sequestration in the cytoplasm occurs. Following growth factor treatment, the protein is free for membrane translocation, and it moves from the cytoplasm to the cell periphery (By similarity)." THRFSTKSWLSQVCHVCQKSMIFGVKCKHCRLKCHNKCTKEAPAC VHQWAVRWTEGADQTDDSSFCSYCDESCSSSFLGGSPIWCCLWCQRLVHVDCHSNMSNETGDIC KSR1_MOUSE Mouse 1 " FUNCTION: Location-regulated scaffolding protein connecting MEK to RAF. Promotes MEK and RAF phosphorylation and activity through assembly of an activated signaling complex. By itself, it has no demonstrated kinase activity." " SUBCELLULAR LOCATION: Cytoplasm. Membrane; peripheral membrane protein. In unstimulated cells, where the phosphorylated form is bound to a 14-3-3 protein, sequestration in the cytoplasm occurs. Following growth factor treatment, the protein is free for membrane translocation, and it moves from the cytoplasm to the cell periphery." THRFSTKSWLSQVCNVCQKSMIFGVKCKHCRLKCHNKCTKEAPAC LHHWVEGNCYGRCSKCRKRIKAYHGITGLTCRWCHMMLHNRCASSVKKEC KSR2_HUMAN Human 1 FUNCTION: Location-regulated scaffold connecting MEK to RAF. Blocks MAP3K8 kinase activity and MAP3K8-mediated signaling. SUBCELLULAR LOCATION: Cytoplasm (By similarity). Membrane; peripheral membrane protein (By similarity). KHRFSTKYWMSQTCTVCGKGMLFGLKCKNCKLKCHNKCTKEAPPC YHHWQDANATAKCVKCKATVGVFQGKGCRWCHNYVHHRCMSALAQEC MHCK_DICDI Others 1 " FUNCTION: Brings about phosphorylation of specific threonines in the heavy chains of myosin during chemotaxis, which results in inhibition of myosin thick filament formation. Phosphorylation also inhibits the actin-activated ATPase activity of myosin." SUBCELLULAR LOCATION: Membrane; peripheral membrane protein. DVKFPKISYNIKIRITKFCNYCRETTFTISGEPVMCSECRYIAHGHCQTKVPLNC SHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHEC ROCK1_HUMAN Human 1 " FUNCTION: Protein kinase that phosphorylates a large number of important signaling proteins, and thereby regulates the assembly of the actin cytoskeleton, cell migration, invasiveness of tumor cells, smooth muscle contraction and neurite outgrowth. Necessary for apoptotic membrane blebbing. Plays a role in smooth muscle contraction. Required for centromere positioning and centromere- dependent exit from mitosis (By similarity)." SUBCELLULAR LOCATION: Cytoplasm. Associated with the mother centriole and an intercentriolar linker (By similarity). Golgi apparatus; Golgi membrane; peripheral membrane protein. A small proportion is associated with Golgi membranes. GHEFIPTLYHFPANCDACAKPLWHVFKPPPALECRRCHVKCHRDHLDKKEDLIC SHLWVRGGCHSGRCDRCQKKIRTYHSLTGLHCVWCHLEIHDDCLQAVGPEC ROCK1_MOUSE Mouse 1 " FUNCTION: Protein kinase that phosphorylates a large number of important signaling proteins, and thereby regulates the assembly of the actin cytoskeleton, cell migration, invasiveness of tumor cells, smooth muscle contraction and neurite outgrowth. Necessary for apoptotic membrane blebbing. Plays a role in smooth muscle contraction. Required for centromere positioning and centromere- dependent exit from mitosis (By similarity)." SUBCELLULAR LOCATION: Cytoplasm. Associated with the mother centriole and an intercentriolar linker. Golgi apparatus; Golgi membrane; peripheral membrane protein (By similarity). A small proportion is associated with Golgi membranes (By similarity). GHEFIPTLYHFPANCEACAKPLWHVFKPPPALECRRCHVKCHRDHLDKKEDLISPC THVWVRGGCESGRCDRCQKKIRIYHSLVGLHCVWCHLEIHDDCLPAMGHEC ROCK1_PANTR Others 1 " FUNCTION: Protein kinase that phosphorylates a large number of important signaling proteins, and thereby regulates the assembly of the actin cytoskeleton, cell migration, invasiveness of tumor cells, smooth muscle contraction and neurite outgrowth. Necessary for apoptotic membrane blebbing. Plays a role in smooth muscle contraction. Required for centromere positioning and centromere- dependent exit from mitosis (By similarity)." SUBCELLULAR LOCATION: Cytoplasm. Associated with the mother centriole and an intercentriolar linker. Golgi apparatus; Golgi membrane; peripheral membrane protein (By similarity). A small proportion is associated with Golgi membranes (By similarity). GHEFIPTLYHFPANCDACAKPLWHVFKPPPALECRRCHVKCHRDHLDKKEDLIC PHVWVRGGCHSGRCDRCQKKIRTYHSLTGLHCVWCHLEIHDDCLQAVGPEC ROCK1_RABIT Others 1 " FUNCTION: Protein kinase that phosphorylates a large number of important signaling proteins, and thereby regulates the assembly of the actin cytoskeleton, cell migration, invasiveness of tumor cells, smooth muscle contraction and neurite outgrowth. Necessary for apoptotic membrane blebbing. Plays a role in smooth muscle contraction. Required for centromere positioning and centromere- dependent exit from mitosis (By similarity)." SUBCELLULAR LOCATION: Cytoplasm. Associated with the mother centriole and an intercentriolar linker. Golgi apparatus; Golgi membrane; peripheral membrane protein (By similarity). A small proportion is associated with Golgi membranes (By similarity). GHEFIPTLYHFPANCEACAKPLWHVFKPPPALECRRCHVKCHRDHLDKKEDLISPC HHYWVEGNCPTKCDKCHKTVKCYQGLTGLHCVWCQITLHNKCASHLKPEC ROCK1_RAT Others 1 " FUNCTION: Protein kinase that phosphorylates a large number of important signaling proteins, and thereby regulates the assembly of the actin cytoskeleton, cell migration, invasiveness of tumor cells, smooth muscle contraction and neurite outgrowth. Necessary for apoptotic membrane blebbing. Plays a role in smooth muscle contraction. Required for centromere positioning and centromere- dependent exit from mitosis (By similarity)." SUBCELLULAR LOCATION: Cytoplasm. Associated with the mother centriole and an intercentriolar linker. Golgi apparatus; Golgi membrane; peripheral membrane protein (By similarity). A small proportion is associated with Golgi membranes (By similarity). GHEFIPTLYHFPANCEACAKPLWHVFKPPPALECRRCHVKSHRDHLDKKEDLIPPC HHYWVEGNCPTKCDKCHKTVKCYQGLTGLHCVWCQTTLHNKCASHLKPEC ROCK2_HUMAN Human 1 " FUNCTION: Protein kinase that phosphorylates a large number of important signaling proteins, and thereby regulates the assembly of the actin cytoskeleton. Promotes formation of stress fibers and of focal adhesion complexes. Plays a role in smooth muscle contraction (By similarity)." " SUBCELLULAR LOCATION: Cytoplasm (By similarity). Cell membrane; peripheral membrane protein (By similarity). Cytoplasmic, and associated with actin microfilaments and the plasma membrane (By similarity)." GHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPC PHQWLEGNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTSCKESLLTKC ROCK2_MOUSE Mouse 1 " FUNCTION: Protein kinase that phosphorylates a large number of important signaling proteins, and thereby regulates the assembly of the actin cytoskeleton. Promotes formation of stress fibers and of focal adhesion complexes. Plays a role in smooth muscle contraction." " SUBCELLULAR LOCATION: Cytoplasm (By similarity). Cell membrane; peripheral membrane protein (By similarity). Cytoplasmic, and associated with actin microfilaments and the plasma membrane (By similarity)." GHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPC PHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCLWCKAMVHTACKDLYHPVC UN13A_HUMAN Human 1 FUNCTION: Plays a role in vesicle maturation during exocytosis as a target of the diacylglycerol second messenger pathway. Is involved in neurotransmitter release by acting in synaptic vesicle priming prior to vesicle fusion and participates in the activity- depending refilling of readily releasable vesicle pool (RRP). Essential for synaptic vesicle maturation in most excitatory/glutamatergic but not inhibitory/GABA-mediated synapses (By similarity). Involved in secretory granule priming in insulin secretion (By similarity). SUBCELLULAR LOCATION: Cell membrane; peripheral membrane protein (By similarity). Localized to the active zone of presynaptic density. Translocated to the plasma membrane as response to phorbol ester binding (By similarity). PHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADC PHHWIRGNVPLCSYCMVCKQQCGCQPKLCDYRCIWCQKTVHDECMKNSLKNEKC UN13A_RAT Others 1 FUNCTION: Plays a role in vesicle maturation during exocytosis as a target of the diacylglycerol second messenger pathway. Is involved in neurotransmitter release by acting in synaptic vesicle priming prior to vesicle fusion and participates in the activity- depending refilling of readily releasable vesicle pool (RRP). Essential for synaptic vesicle maturation in most excitatory/glutamatergic but not inhibitory/GABA-mediated synapses. Involved in secretory granule priming in insulin secretion (By similarity). SUBCELLULAR LOCATION: Cytoplasm. Membrane; peripheral membrane protein. Cell membrane. Localized to the active zone of presynaptic density. Translocated to the plasma membrane in response to phorbol ester binding. PHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADC PHHWIRGNVPLCSYCVFCRQQCGSQPKLCDYRCIWCQKTVHDECMRGSLRSEKC UN13B_HUMAN Human 1 FUNCTION: Plays a role in vesicle maturation during exocytosis as a target of the diacylglycerol second messenger pathway. Is involved in neurotransmitter release by acting in synaptic vesicle priming prior to vesicle fusion and participates in the activity- depending refilling of readily releasable vesicle pool (RRP). Essential for synaptic vesicle maturation in a subset of excitatory/glutamatergic but not inhibitory/GABA-mediated synapses (By similarity). SUBCELLULAR LOCATION: Cytoplasm (By similarity). Membrane; peripheral membrane protein (By similarity). Cell membrane (By similarity). Localized to synapses. Translocated to the plasma membrane in response to phorbol ester binding (By similarity). PHNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLNADC QHAWVEGNSSVKCDRCHKSIKCYQSVTARHCVWCRMTFHRKCELSTLCDG UN13B_MOUSE Mouse 1 FUNCTION: Plays a role in vesicle maturation during exocytosis as a target of the diacylglycerol second messenger pathway. Is involved in neurotransmitter release by acting in synaptic vesicle priming prior to vesicle fusion and participates in the activity- depending refilling of readily releasable vesicle pool (RRP) (By similarity). Essential for synaptic vesicle maturation in a subset of excitatory/glutamatergic but not inhibitory/GABA-mediated synapses. SUBCELLULAR LOCATION: Cytoplasm. Membrane; peripheral membrane protein. Golgi apparatus. Localized to synapses (By similarity). Translocates to the Golgi in response to phorbol ester binding. PHNFEVWSATTPTYCYECEGLLWAVARQGMRCSECGVKCHEKCQDLLNADC QHAWVEGNSSVKCDRCHKSIKCYQSVTARHCVWCRMTFHRKCELSTVC UN13B_RAT Others 1 " FUNCTION: Plays a role in vesicle maturation during exocytosis as a target of the diacylglycerol second messenger pathway. Is involved in neurotransmitter release by acting in synaptic vesicle priming prior to vesicle fusion and participates in the activity- depending refilling of readily releasable vesicle pool (RRP), Essential for synaptic vesicle maturation in a subset of excitatory/glutamatergic but not inhibitory/GABA-mediated synapses (By similarity)." SUBCELLULAR LOCATION: Cytoplasm. Membrane; peripheral membrane protein. Cell membrane. Localized to synapses. Translocated to the plasma membrane in response to phorbol ester binding. PHNFEVWSATTPTYCYECEGLLWGLARQGMRCSECGVKCHEKCQDLLNADC QHAWVEGNSSVKCDRCHKSIKCYQSVTARHCVWCRMTFHRKCELSTAC UN13C_HUMAN Human 1 FUNCTION: Probably plays a role in vesicle maturation during exocytosis as a target of the diacylglycerol second messenger pathway. Probably is involved in neurotransmitter release. SUBCELLULAR LOCATION: Cytoplasm (By similarity). Membrane; peripheral membrane protein (By similarity). Localized to presynaptic structures (By similarity). PHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEKCQDLLNADC AHCFGPRGLHKRKFCAVCRKVLEAPALHCEVCELHLHPDCVPFACSDC HHHWREGNLPSGARCEVCRKTCGSSDVLAGVRCEWCGVQAHSLCSAALAPEC UN13C_MOUSE Mouse 1 FUNCTION: Probably plays a role in vesicle maturation during exocytosis as a target of the diacylglycerol second messenger pathway. Probably is involved in neurotransmitter release. SUBCELLULAR LOCATION: Cytoplasm (By similarity). Membrane; peripheral membrane protein (By similarity). Localized to presynaptic structures (By similarity). PHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEKCQDLLNADC DGK2_DROME Others 1 FUNCTION: Required for the maintenance of the photoreceptor. Its absence leads to rhabdomere degeneration due to defective phospholipid turnover. Mutants of this gene are characterized by having photoreceptor cells that develop normally but degenerate rapidly after eclosion. SUBCELLULAR LOCATION: Membrane; peripheral membrane protein. HYWKPTSASGDLCCLNEECIKSGQRMKCSACQLVAHHNCIPFVNEKSTLAC ARAF_HUMAN Human 1 FUNCTION: Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. MHNFVRKTFFSLAFCDFCLKFLFHGFRCQTCGYKFHQHCSSKVPTVC ARAF_MOUSE Mouse 1 FUNCTION: Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. MHNFVRKTFFSLAFCDFCLKFLFHGFRCQTCGYKFHQHCSSKVPTVC PHRFSVHSYKRPTFCDHCGSMLYGLINQGLQCSTCKLNVHKRCQRNVANNC ARAF_PIG Others 1 FUNCTION: Involved in the transduction of mitogenic signals from the cell membrane to the nucleus (By similarity). MHNFVRKTFFSLAFCDFCLKFLFHGFRCQTCGYKFHQHCSSKVPTVC LHKFKLHSYGSPTFCDHCGSLLYGLLHQGLKCDSCDMNVHKRCEKNVPLLC ARAF_RAT Others 1 FUNCTION: Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. MHNFVRKTFFSLAFCDFCLKFLFHGFRCQTCGYKFHQHCSSKVPTVC PHRFEGFSNISANWCCHCGYLLPFGRKNAKRCTECGLTCHSHCTHLVPDFC ATX1_ARATH Mouse 1 " FUNCTION: Histone methyltransferase. Methylates Lys-4 of histone H3. H3 Lys-4 methylation represents a specific tag for epigenetic transcriptional activation. Required to maintain the active state of class A (AP1 and AP2), class B (PI and AP3) and class C (AG) floral homeotic genes at early stages of flower development. Regulates floral organ identity and flowering transition. Functions as a receptor for the lipid messenger phosphatidylinositol 5-phosphate (PI5P), which regulates negatively its transcriptional activation activity." " SUBCELLULAR LOCATION: Nucleus. Cytoplasm. Shifts from nucleus to cytoplasm as PIP5 levels increase. When in the nucleus, associated with chromatin. When cytopasmic, mostly localized along the plasma membrane, associated with PIP5." RHQNQPTGYRPVRVDWKDLDKCNVCHMDEEYENNLFLQCDKCRMMVHAKCYGELEPC PHRFKTYNFKSPTFCDHCGSMLYGLFKQGLRCEVCNVACHHKCERLMSNLC BRAF1_HUMAN Human 1 FUNCTION: Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. May play a role in the postsynaptic responses of hippocampal neuron. SUBCELLULAR LOCATION: Cytoplasm. THNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMC PHRFEPITNHGTKWCCHCGYILPWGKKNVRKCTECGVMCHAQCTHLVPDFC CHIN_HUMAN Human 1 FUNCTION: GTPase-activating protein for p21-rac and a phorbol ester receptor. May play an important role in neuronal signal- transduction mechanisms. IHNFKVHTFRGPHWCEYCANFMWGLIAQGVKCADCGLNVHKQCSKMVPNDC PHRFENFSNMGANWCCHCGYVLPLGRKQTKKCNECGLTCHAHCVHFVPDFC CHIN_MOUSE Mouse 1 FUNCTION: GTPase-activating protein for p21-rac and a phorbol ester receptor. May play an important role in neuronal signal- transduction mechanisms (By similarity). VHNFKVHTFRGPHWCEYCANFMWGLIAQGVKCADCGLNVHKQCSKMVPNDC QHNFEPFTYAGPTFCDHCGSLLYGIYHQGLKCSACDMNVHARCKENVPSLC CHIN_RAT Others 1 FUNCTION: GTPase-activating protein for p21-rac and a phorbol ester receptor. May play an important role in neuronal signal- transduction mechanisms. VHNFKVHTFRGPHWCEYCANFMWGLIAQGVKCADCGLNVHKQCSKMVPNDC KHKFKVHSYNSPTFCDHCGSLLYGLYHQGMKCGACDMNVHKRCQKSVPNLC DGK1_DROME Others 1 " FUNCTION: Upon cell stimulation converts the second messenger diacylglycerol into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity (By similarity). May have a role in the development of the embryonic nervous system and the function of the adult nervous system and muscle; regulating signal transduction in neurons." IHVWRLKHFSKPAYCNLCLNMLVGLGKKGLCCVLCKYTVHERCVQHAPASC PHRFIPFSNLTANWCCHCGYMLPIGSKKNSRKCSECALTAHAQCVHLVPDFC DGKA_HUMAN Human 1 " FUNCTION: Upon cell stimulation converts the second messenger diacylglycerol into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity." QHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPC PHRFQPFSNVTANWCCHCGYILPFGKKNCRKCSECGLTSHAQCVHLVPDFC DGKA_MOUSE Mouse 1 " FUNCTION: Upon cell stimulation converts the second messenger diacylglycerol into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity (By similarity)." NHIWRPKRFTRLVYCNLCEQSISLGKQGLSCNFCKYIVHDHCAMKAQPC PHRFLPTSNRGTKWCCHCGYILPWGRHKVRKCSECGIMCHAQCAHLVPDFC DGKA_PIG Others 1 " FUNCTION: Upon cell stimulation converts the second messenger diacylglycerol into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity." QHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPC PHRFNVHNYRRPTFCDHCGSLLYGLVRQGLQCDVCKMNIHKRCQKNVANNC DGKA_RAT Others 1 " FUNCTION: Upon cell stimulation converts the second messenger diacylglycerol into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity." HHIWRPKRFSRPVYCNLCELSIGLGKQGLSCNLCKYIVHDHCAMKAQPC QHKWKVQTYSSPTFCDHCGSLLYGILHQGMKCQSCDTNVHHRCVKNVPNMC DGKB_HUMAN Human 1 FUNCTION: Exhibits high phosphorylation activity for long-chain diacylglycerols (By similarity). SUBCELLULAR LOCATION: Cytoplasm (By similarity). QHVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSC KHGWISTTYTTPTFCDECGLLLHGVAHQGVKCENCNLNVHHACQETVPPMC DGKB_RAT Others 1 FUNCTION: Exhibits high phosphorylation activity for long-chain diacylglycerols. SUBCELLULAR LOCATION: Cytoplasm. Membrane. Can be loosely bound to the membranes. QHVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCARAPPSC DGKE_HUMAN Human 1 FUNCTION: Highly selective for arachidonate-containing species of diacylglycerol (DAG). May terminate signals transmitted through arachidonoyl-DAG or may contribute to the synthesis of phospholipids with defined fatty acid composition. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein (Potential). KHGWRDTDLFSQPTYCCVCAQHILQGAFCDCCGLRVDEGCLRKADKRFQC PHRFVVHSYKRFTFCDHCGSLLYGLIKQGLQCETCGMNVHKRCQKNVANTC DGKE_MOUSE Mouse 1 FUNCTION: Highly selective for arachidonate-containing species of diacylglycerol (DAG). May terminate signals transmitted through arachidonoyl-DAG or may contribute to the synthesis of phospholipids with defined fatty acid composition (By similarity). SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein (Potential). KHCWRDTDLFSHPTYCCVCAQHILQGAFCDCCGLRVDEGCLKKVDKRFPC PHRFKPHTFMSPTFCDHCGSLMGGFFIQGLKCEECDVNCHKKCERLTANLC DGKG_HUMAN Human 1 FUNCTION: Reverses the normal flow of glycerolipid biosynthesis by phosphorylating diacylglycerol back to phosphatidic acid. SUBCELLULAR LOCATION: Cytoplasm. Membrane. Can be loosely bound to the membranes. GHAWTMKHFKKPTYCNFCHIMLMGVRKQGLCCTYCKYTVHERCVSKNIPGC KHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLC KPC1_APLCA Others 1 " FUNCTION: This is calcium-dependent, phospholipid-dependent, serine- and threonine-specific enzyme. Activation of PKC by serotonin results in presynaptic facilitation of depressed sensory-to-motor neuron synapses, which is thought to underlie behavioral dishabituation. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters (By similarity)." SUBCELLULAR LOCATION: Cytoplasmic; translocated to neuronal membranes. NHKFLARFFKQPTFCSHCKDFIWGFGKQGFQCQVCSLVVHKRCHEFVCFIC KHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLC KPC1_CAEEL Others 1 " FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." GHQFVATFFRQPHFCSLCSDFMWGLNKQGYQCQLCSAAVHKKCHEKVIMQC KHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINDPSLC KPC1_DROME Others 1 " FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." DHCFIARFFKQPTFCSHCKDFICGYQSGYAWMGFGKQGFQCQVCSYVVHKRCHEYVTFIC KHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLC KPC1_LYTPI Others 1 " FUNCTION: This is a calcium-activated, phospholipid-dependent, serine- and threonine-specific enzyme (By similarity). FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters (By similarity)." NHKFIPRFFKQPTFCSHCKDFIWGFGKQGFQCKVCSFVVHKRCHEFVTFQC KHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLC KPC2_CAEEL Others 1 " FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." SHKFIARFFKQPTFCSHCKDFLWGITKQGFQCQVCTLVVHKRCHEFVNFAC KHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLC KPC2_DROME Others 1 " FUNCTION: This is a calcium-activated, phospholipid-dependent, serine- and threonine-specific enzyme. This isozyme is a negative regulator of the visual transduction cascade and has been shown to be required for photoreceptor cell inactivation and light adaptation. Negative regulation is dependent on interaction with scaffolding protein inaD." GHRFGVRFFKNPTYCGHCKDFIWGFGKQGFQCEECRFNIHQKCCKFVVFKC KHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLC KPC3_DROME Others 1 " FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." GHKFMATFLRQPTFCSHCREFIWGIGKQGYQCQVCTLVVHKKCHLSVVSKC KHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLC KPCA_BOVIN Others 1 " FUNCTION: This is a calcium-activated, phospholipid-dependent, serine- and threonine-specific enzyme. May play a role in cell motility by phosphorylating CSPG4 (By similarity). FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." NHRFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSC KHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLC KPCA_HUMAN Human 1 " FUNCTION: This is a calcium-activated, phospholipid-dependent, serine- and threonine-specific enzyme. May play a role in cell motility by phosphorylating CSPG4. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." DHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSC KHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLC KPCA_MOUSE Mouse 1 " FUNCTION: This is a calcium-activated, phospholipid-dependent, serine- and threonine-specific enzyme. May play a role in cell motility by phosphorylating CSPG4 (By similarity). FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." DHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSC PHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQCKDCRFNCHKRCAPKVPNNC KPCA_RABIT Others 1 " FUNCTION: This is a calcium-activated, phospholipid-dependent, serine- and threonine-specific enzyme. May play a role in cell motility by phosphorylating CSPG4 (By similarity). FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." DHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSC PHTFVIHSYTRPTVCQFCKKLLKGLFRQGLQCKDCRFNCHKRCAPKVPNNC KPCA_RAT Others 1 " FUNCTION: This is a calcium-activated, phospholipid-dependent, serine- and threonine-specific enzyme. May play a role in cell motility by phosphorylating CSPG4 (By similarity). FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." DHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSC PHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCKFNCHKRCATRVPNDC KPCD1_HUMAN Human 1 " FUNCTION: This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme." PHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNC PHTFAVHSYTRPTICQYCKRLLKGLFRQGMQCKDCKFNCHKRCASKVPRDC KPCD1_MOUSE Mouse 1 " FUNCTION: This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme." PHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNC PHTFAVHSYGRPTICQYCKRLLKGLFRQGMQCKDCKFNCHKRCASKVPRDC KPCD2_HUMAN Human 1 " FUNCTION: Calcium-independent, phospholipid-dependent, serine- and threonine-specific protein kinase." PHALTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRCAFSIPNNC PHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCQKKVANLC KPCD3_HUMAN Human 1 " FUNCTION: This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." PHTLYVHSYKAPTFCDYCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNC PHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLC KPCD3_MOUSE Mouse 1 " FUNCTION: This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters (By similarity)." PHALYVHSYKAPTFCDYCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNC PHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLC KPCE_HUMAN Human 1 " FUNCTION: This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." GHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKC PHRFKVYNYMSPTFCDHCGTLLWGLVKQGLKCEDCGMNVHHKCREKVANLC KPCE_MOUSE Mouse 1 " FUNCTION: This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." GHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKC PHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNC KPCE_RABIT Others 1 " FUNCTION: This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." GHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKV PHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNC KPCE_RAT Others 1 " FUNCTION: This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." GHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKC PHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNC KPCG_BOVIN Others 1 " FUNCTION: This is a calcium-activated, phospholipid-dependent, serine- and threonine-specific enzyme. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." SHKFTARFFKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFEC PHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNC KPCG_HUMAN Human 1 " FUNCTION: This is a calcium-activated, phospholipid-dependent, serine- and threonine-specific enzyme. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." SHKFTARFFKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFEC KHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLC KPCG_MOUSE Mouse 1 " FUNCTION: This is a calcium-activated, phospholipid-dependent, serine- and threonine-specific enzyme. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." SHKFTARFFKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFEC KHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLC KPCG_RABIT Others 1 " FUNCTION: This is a calcium-activated, phospholipid-dependent, serine- and threonine-specific enzyme. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." SHKFTARFFKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFEC KHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLC KPCG_RAT Others 1 " FUNCTION: This is a calcium-activated, phospholipid-dependent, serine- and threonine-specific enzyme. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." SHKFTARFFKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFEC KHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRTVPSLC KPCI_BRARE Others 1 " FUNCTION: Calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. Is required for the formation and maintenance of the zonula adherens during early epithelial development and plays a critical role in organ morphogenesis and in regulating the orientation of cell division. May play a role in the secretory response to nutrients. Involved in cell polarization processes and the formation of epithelial tight junctions (By similarity)." GHAFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTVEC KHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLC KPCI_HUMAN Human 1 " FUNCTION: Calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. Is not activated by phorbol esters or diaglycerol. May play a role in the secretory response to nutrients. Involved in cell polarization processes and the formation of epithelial tight junctions." SUBCELLULAR LOCATION: Endosome. GHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIEC KPCI_MOUSE Mouse 1 " FUNCTION: Calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. Is not activated by phorbol esters or diaglycerol. May play a role in the secretory response to nutrients. Involved in cell polarization processes and the formation of epithelial tight junctions." SUBCELLULAR LOCATION: Endosome (By similarity). GHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIEC KPCI_PONPY Others 1 " FUNCTION: Calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. Is not activated by phorbol esters or diaglycerol. May play a role in the secretory response to nutrients. Involved in cell polarization processes and the formation of epithelial tight junctions (By similarity)." SUBCELLULAR LOCATION: Endosome (By similarity). GHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIEC KPCL_HUMAN Human 1 " FUNCTION: This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." GHKFMATYLRQPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTAC KPCL_MOUSE Mouse 1 " FUNCTION: This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." GHKFMATYLRQPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTAC PHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNC KPCL_RAT Others 1 " FUNCTION: This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." GHKFMATYLRQPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTAC PHKFNVHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNC KPCT_HUMAN Human 1 " FUNCTION: This is a calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. Essential for T-cell receptor (TCR)-mediated T-cell activation, but is dispensable during TCR-dependent thymocyte development. Links the TCR signaling complex to the activation of NF-kappa-B in mature T lymphocytes. Required for interleukin-2 (IL2) production. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." CHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKC PHKFNVHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNC KPCT_MOUSE Mouse 1 " FUNCTION: This is a calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. Essential for T-cell receptor (TCR)-mediated T-cell activation, but is dispensable during TCR-dependent thymocyte development. Links the TCR signaling complex to the activation of NF-kappa-B in mature T lymphocytes. Required for interleukin-2 (IL2) production. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters." CHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKC PHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLC KPCZ_HUMAN Human 1 " FUNCTION: This is a calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters. Subunit of a quaternary complex that plays a central role in epithelial cell polarization." " SUBCELLULAR LOCATION: Cytoplasm. In the retina, localizes in the terminals of the rod bipolar cells (By similarity). Endosome. Associates with endosomes." GHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTC PHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLC KPCZ_MOUSE Mouse 1 " FUNCTION: This is a calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. Phosphorylates KCNAB2. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters. Subunit of a quaternary complex that plays a central role in epithelial cell polarization." " SUBCELLULAR LOCATION: Cytoplasmic. In the retina, localizes in the terminals of the rod bipolar cells. Associated with endosomes (By similarity)." GHLFQAKRFNRGAYCGQCSERIWGLSRQGYRCINCKLLVHKRCHVLVPLTC KPCZ_RABIT Others 1 " FUNCTION: This is a calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. Phosphorylates KCNAB2. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters. Subunit of a quaternary complex that plays a central role in epithelial cell polarization (By similarity)." " SUBCELLULAR LOCATION: Cytoplasm (By similarity). In the retina, localizes in the terminals of the rod bipolar cells. Endosome (By similarity). Associated with endosomes (By similarity)." GHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTC KPCZ_RAT Others 1 " FUNCTION: This is a calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme. Phosphorylates KCNAB2. FUNCTION: PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters. Subunit of a quaternary complex that plays a central role in epithelial cell polarization (By similarity)." " SUBCELLULAR LOCATION: Cytoplasm. In the retina, localizes in the terminals of the rod bipolar cells." GHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHVLVPLTC RAF1_HUMAN Human 1 FUNCTION: Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. Part of the Ras-dependent signaling pathway from receptors to the nucleus. THNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMC RAF1_MOUSE Mouse 1 FUNCTION: Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. Part of the Ras-dependent signaling pathway from receptors to the nucleus (By similarity). THNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMC RAF1_RAT Others 1 FUNCTION: Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. Part of the Ras-dependent signaling pathway from receptors to the nucleus. THNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMC RAF1_XENLA Others 1 FUNCTION: Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. Part of the Ras-dependent signaling pathway from receptors to the nucleus. THNFVRKTFLKLAFCDICQKFLLNAFRCQTCGYKFHEHCSTKVPTMC ROCK2_BOVIN Others 1 " FUNCTION: Protein kinase that phosphorylates a large number of important signaling proteins, and thereby regulates the assembly of the actin cytoskeleton. Promotes formation of stress fibers and of focal adhesion complexes. Plays a role in smooth muscle contraction (By similarity)." " SUBCELLULAR LOCATION: Cytoplasm. Cell membrane; peripheral membrane protein. Cytoplasmic, and associated with actin microfilaments and the plasma membrane." GHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPC ROCK2_RAT Others 1 " FUNCTION: Protein kinase that phosphorylates a large number of important signaling proteins, and thereby regulates the assembly of the actin cytoskeleton. Promotes formation of stress fibers and of focal adhesion complexes. Plays a role in smooth muscle contraction." " SUBCELLULAR LOCATION: Cytoplasm. Cell membrane; peripheral membrane protein. Cytoplasmic, and associated with actin microfilaments and the plasma membrane." GHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECSRCHIKCHKDHMDKKEEIIAPC UNC13_CAEEL Others 1 " FUNCTION: May form part of a signal transduction pathway, transducing the signal from diacylglycerol to effector functions. One such function could be the release of neurotransmitter from neurons." SLAVPMSPGPYLNSDPPSPVSPNPQIKRSIYRIKESYEDRNGGRERIYTT RHHWVEGNLKKSKKCIHCMEPCEKSFSLAHYKCLWCHKYLHSSCFDKHNPIC ARHG2_HUMAN Human 1 " FUNCTION: Stimulates guanine nucleotide exchange of Rac and Rho but is inactive toward CDC42, TC10, or Ras. Binds to Rac and Rho proteins in both the GDP- and guanosine 5'-3-O-(thio)triphosphate- bound states without detectable affinity for CDC42 or Ras. May have a direct role in activation of Rac and/or Rho and in bringing the activated GTPase to specific target sites such as microtubules." SUBCELLULAR LOCATION: Cytoplasm. Colocalizes with microtubules through the C-terminal coiled-coil domain. GHLFTTISVSGMTMCYACNKSITAKEALICPTCNVTIHNRCKDTLANC ARHG2_MOUSE Mouse 1 " FUNCTION: Stimulates guanine nucleotide exchange of Rac and Rho but is inactive toward CDC42, TC10, or Ras. Binds to Rac and Rho proteins in both the GDP- and guanosine 5'-3-O-(thio)triphosphate- bound states without detectable affinity for CDC42 or Ras. May have a direct role in activation of Rac and/or Rho and in bringing the activated GTPase to specific target sites such as microtubules (By similarity)." SUBCELLULAR LOCATION: Cytoplasm (By similarity). Colocalizes with microtubules through the C-terminal coiled-coil domain (By similarity). GHLFTTISVSGMTMCYACNKSITAKEALICPTCNVTIHNRCKDTLANC BRAF1_CHICK Others 1 FUNCTION: May play a role in transducing specific signals in neural cells. SUBCELLULAR LOCATION: Nucleus. THNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMC BRAF1_COTJA Others 1 FUNCTION: May play a role in transducing specific signals in neural cells. SUBCELLULAR LOCATION: Nucleus. THNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMC KPC3_CAEEL Others 1 " FUNCTION: Required for the normal progression of embryogenesis and viability of the organism. Plays an indispensable role in establishing embryonic polarity and in recruiting and maintaining par-6 to the periphery, through interaction with par-3. Required for epithelial cell polarity in the distal spermatheca. Phosphorylates serine residues of num-1." " SUBCELLULAR LOCATION: Targeted and anchored at the apical surface (villi) of intestinal and pharyngeal cells, and in proximity with the cortical actin cytoskeleton that lies under the plasma membrane. Tightly bound to organelles/cytoskeleton in six of the seven developmental stages. Accumulation in cytoplasm is restricted to L1 larvae and adults." GHRFQAKRLNRRIQCFICHDYIWGIGRQGFRCVDCRLCVHKKCHRHVRTHC MRCKA_HUMAN Human 1 " FUNCTION: May act as a downstream effector of CDC42 in cytoskeletal reorganization. Contributes to the actomyosin contractility required for cell invasion, through the regulation of MYPT1 and thus MLC2 phosphorylation." " SUBCELLULAR LOCATION: Cytoplasmic. Displays a dispersed punctate distribution and concentrates along the cell periphery, especially at the leading edge and cell-cell junction. This concentration is PH-domain dependent (By similarity)." THQFFVKSFTTPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCVNKAPTTC MRCKA_RAT Others 1 " FUNCTION: May act as a downstream effector of CDC42 in cytoskeletal reorganization. Contributes to the actomyosin contractility required for cell invasion, through the regulation of MYPT1 and thus MLC2 phosphorylation." " SUBCELLULAR LOCATION: Cytoplasmic. Displays a dispersed punctate distribution and concentrates along the cell periphery, especially at the leading edge and cell-cell junction. This concentration is PH-domain dependent." THQFFVKSFTAPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCVNKAPTTC MRCKB_HUMAN Human 1 " FUNCTION: May act as a downstream effector of CDC42 in cytoskeletal reorganization. Contributes to the actomyosin contractility required for cell invasion, through the regulation of MYPT1 and thus MLC2 phosphorylation (By similarity)." " SUBCELLULAR LOCATION: Cytoplasmic. Displays a dispersed punctate distribution and concentrates along the cell periphery, especially at the leading edge and cell-cell junction. This concentration is PH-domain dependent (By similarity)." AHQFSIKSFSSPTQCSHCTSLMVGLIRQGYACEVCSFACHVSCKDGAPQVC MRCKB_MOUSE Mouse 1 " FUNCTION: May act as a downstream effector of CDC42 in cytoskeletal reorganization. Contributes to the actomyosin contractility required for cell invasion, through the regulation of MYPT1 and thus MLC2 phosphorylation (By similarity)." " SUBCELLULAR LOCATION: Cytoplasmic. Displays a dispersed punctate distribution and concentrates along the cell periphery, especially at the leading edge and cell-cell junction. This concentration is PH-domain dependent (By similarity)." AHQFSIKSFPSPTQCSHCTSLMVGLIRQGYACEVCAFSCHVSCKDSAPQVC MRCKB_RAT Others 1 " FUNCTION: May act as a downstream effector of CDC42 in cytoskeletal reorganization. Contributes to the actomyosin contractility required for cell invasion, through the regulation of MYPT1 and thus MLC2 phosphorylation (By similarity)." " SUBCELLULAR LOCATION: Cytoplasmic. Displays a dispersed punctate distribution and concentrates along the cell periphery, especially at the leading edge and cell-cell junction. This concentration is PH-domain dependent (By similarity)." AHQFSIKSFPSPTQCSHCTSLMVGLIRQGYACEVCAFSCHVSCKDSAPQVC MRCKG_HUMAN Human 1 " FUNCTION: May act as a downstream effector of CDC42 in cytoskeletal reorganization. Contributes to the actomyosin contractility required for cell invasion, through the regulation of MYPT1 and thus MLC2 phosphorylation (By similarity)." SUBCELLULAR LOCATION: Cytoplasm. Concentrates at the leading edge of cells. SHTLRPRSFPSPTKCLRCTSLMLGLGRQGLGCDACGYFCHTTCAPQAPPC MRCKG_MOUSE Mouse 1 " FUNCTION: May act as a downstream effector of CDC42 in cytoskeletal reorganization. Contributes to the actomyosin contractility required for cell invasion, through the regulation of MYPT1 and thus MLC2 phosphorylation (By similarity)." SUBCELLULAR LOCATION: Cytoplasm. Concentrates at the leading edge of cells (By similarity). SHTLRPRSFPSPTKCLRCTSLMLGLGRQGLGCDTCGYFCHSACASQAPPC RASF1_HUMAN Human 1 " FUNCTION: Potential tumor suppressor. Required for death receptor- dependent apoptosis. When associated with MOAP1, promotes BAX conformational change and translocation to mitochondrial membranes in response to TNF and TNFSF10 stimulation. Isoform A interacts with CDC20, an activator of the anaphase-promoting complex, APC, resulting in the inhibition of APC activity and mitotic progression. Inhibits proliferation by negatively regulating cell cycle progression at the level of G1/S-phase transition by regulating accumulation of cyclin D1 protein. Inhibits the activation of STK3 and STK4 and may play an additional role as a scaffold protein, directing these enzymes to sites of activation. Isoform C has been shown not to perform these roles, no function has been identified for this isoform." " SUBCELLULAR LOCATION: Isoform A localizes to cytoplasmic microtubules during interphase, to bipolar centrosomes associated with microtubules during prophase, to spindle fibers and spindle poles at metaphase and anaphase, to the midzone during early telophase, and to the midbody in late telophase in cells. Isoform C is predominantly nuclear." GHRFQPAGPATHTWCDLCGDFIWGVVRKGLQCARLSADCKFTCHYRCRALVCLDC RASF1_MOUSE Mouse 1 " FUNCTION: Potential tumor suppressor. Required for death receptor- dependent apoptosis. When associated with MOAP1, promotes BAX conformational change and translocation to mitochondrial membranes in response to TNF and TNFSF10 stimulation. Isoform A interacts with CDC20, an activator of the anaphase-promoting complex, APC, resulting in the inhibition of APC activity and mitotic progression. Inhibits proliferation by negatively regulating cell cycle progression at the level of G1/S-phase transition by regulating accumulation of cyclin D1 protein. Inhibits the activation of STK3 and STK4 and may play an additional role as a scaffold protein, directing these enzymes to sites of activation. Isoform C has been shown not to perform these roles, no function has been identified for this isoform (By similarity)." " SUBCELLULAR LOCATION: Isoform A localizes to cytoplasmic microtubules during interphase, to bipolar centrosomes associated with microtubules during prophase, to spindle fibers and spindle poles at metaphase and anaphase, to the midzone during early telophase, and to the midbody in late telophase in cells. Isoform C is predominantly nuclear (By similarity)." GHRFQPAGPTTHTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDC RGAP1_HUMAN Human 1 FUNCTION: Essential for the early stages of embryogenesis and may play a role in the microtubule-dependent steps in cytokinesis. Plays key roles in controlling cell growth and differentiation of hematopoietic cells through mechanisms other than regulating Rac GTPase activity. Also involved in the regulation of growth-related processes in adipocytes and myoblasts. May be involved in regulating spermatogenesis and in the RACGAP1 pathway in neuronal proliferation. Shows strong GAP (GTPase activation) activity towards CDC42 and RAC1 and less towards RHOA. Required for initiation of cleavage furrow ingression by regulating ECT2 and for assembly of the contractile ring. May play a role in regulating cortical activity through RHOA during cytokinesis. " SUBCELLULAR LOCATION: During interphase, localized to the nucleus and cytoplasm along with microtubules, in anaphase, is redistributed to the central spindle and, in telophase and cytokinesis, to the midbody. Colocalizes with RHOA at the contractile ring during cytokinesis. Colocalizes with RND2 in Golgi-derived proacrosomal vesicles and the acrosome." LHDFVSKTVIKPESCVPCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPC RGAP1_MOUSE Mouse 1 FUNCTION: Essential for the early stages of embryogenesis and may play a role in the microtubule-dependent steps in cytokinesis. Plays key roles in controlling cell growth and differentiation of hematopoietic cells through mechanisms other than regulating Rac GTPase activity. Also involved in the regulation of growth-related processes in adipocytes and myoblasts. May be involved in regulating spermatogenesis and in the RACGAP1 pathway in neuronal proliferation. Shows strong GAP (GTPase activation) activity towards CDC42 and RAC1 and less towards RHOA. Required for initiation of cleavage furrow ingression by regulating ECT2 and for assembly of the contractile ring. May play a role in regulating cortical activity through RHOA during cytokinesis. " SUBCELLULAR LOCATION: During interphase, localized to the nucleus and cytoplasm along with microtubules, in anaphase, is redistributed to the central spindle and, in telophase and cytokinesis, to the midbody. Colocalizes with RHOA at the contractile ring during cytokinesis (By similarity). Colocalizes with RND2 in Golgi-derived proacrosomal vesicles and the acrosome." LHDFVSKTVIKPESCVPCGKRIKFGKLSLKCRDCRLVSHPECRDRCPLPC STAC_HUMAN Human 1 FUNCTION: Probably involved in a neuron-specific signal transduction. SUBCELLULAR LOCATION: Cytoplasm. AHAFQEYIFKKPTFCDVCNHMIVGTNAKHGLRCKACKMSIHHKCTDGLAPQRC STAC_MOUSE Mouse 1 FUNCTION: Probably involved in a neuron-specific signal transduction. SUBCELLULAR LOCATION: Cytoplasm. LHAFQEHVFKKPTFCDVCNHMIVGTHAKHGLRCGACKMSIHHKCADGLAPQRC PHNFATTTFQTPTFCYECEGLLWGLARQGLRCTQCQVKVHDKCRELLSADC UN13C_RAT Others 1 FUNCTION: Probably plays a role in vesicle maturation during exocytosis as a target of the diacylglycerol second messenger pathway. Probably is involved in neurotransmitter release. SUBCELLULAR LOCATION: Cytoplasm (Probable). Membrane; peripheral membrane protein (Probable). Localized to presynaptic structures (Probable). PHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEKCQDLLNADC DGKZ_HUMAN Human 1 " FUNCTION: Displays a strong preference for 1,2-diacylglycerols over 1,3-diacylglycerols, but lacks substrate specificity among molecular species of long chain diacylglycerols." SUBCELLULAR LOCATION: Cytoplasm. Nucleus. HIWFETNVSGDFCYVGEQYCVARMLKSVSRRKCAACKIVVHTPCIEQLEKINFRC HHWVHRRRQDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMLQQIEEPC DGKZ_MOUSE Mouse 1 " FUNCTION: Displays a strong preference for 1,2-diacylglycerols over 1,3-diacylglycerols, but lacks substrate specificity among molecular species of long chain diacylglycerols (By similarity)." SUBCELLULAR LOCATION: Nucleus (By similarity). HIWFETNVSGDFCYVGEQHCVAKMLPKSAPRKKCAACKIVVHTQCIKQLEKINFRC HHWVHRRRQDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMMQQIEEPC DGKZ_RAT Others 1 " FUNCTION: Displays a strong preference for 1,2-diacylglycerols over 1,3-diacylglycerols, but lacks substrate specificity among molecular species of long chain diacylglycerols." SUBCELLULAR LOCATION: Nucleus. HIWFETNVSGDFCYVGEQYCVAKMLPKSAPRRKCAACKIVVHTPCIGQLEKINFRC HHWVHRRRQDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMLQQIEEPC CTRO_HUMAN Human 0 FUNCTION: Putative RHO/RAC effector that binds to the GTP-bound forms of RHO and RAC1. It probably binds p21 with a tighter specificity in vivo. Dual specificity protein kinase activity catalyzing autophosphorylation and phosphorylation of exogenous substrates on both serine/threonine and tyrosine residues. Plays an important role in the regulation of cytokinesis and the development of the central nervous system (By similarity). SUBCELLULAR LOCATION: Cytoplasm (By similarity). PHRFNVGLNMRATKCAVCLDTVHFGRQASKCLECQVMCHPKCSTCLPATC CTRO_MOUSE Mouse 0 FUNCTION: Probable RHO/RAC effector that binds to the GTP-bound forms of RHO and RAC1. It probably binds p21 with a tighter specificity in vivo. Dual specificity protein kinase activity catalyzing autophosphorylation and phosphorylation of exogenous substrates on both serine/threonine and tyrosine residues. Plays an important role in the regulation of cytokinesis and the development of the central nervous system. SUBCELLULAR LOCATION: Cytoplasm. PHRFNVGLNMRATKCAVCLDTVHFGRQASKCLECQVMCHPKCSTCLPATC DGK1_ARATH Mouse 0 PHSWELDPIARAKNLNCCVCLKSMSPSQAIVASESFFHRCTICGAAAHFNCSSSAPKDC DGK3_CAEEL Others 0 SHVWRLRHFTKPTYCNACCSILVGWGGKQGLSCSLCKYTVHERCVRSAATNC DGKD_MESAU Others 0 MHNWYACSHARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNC DGKG_MOUSE Mouse 0 RHAWTLKHFKKPTYCNFCRAMLMGVGKQGLCCIYCKYTVHQRCVSKTIHGC DGKG_RAT Others 0 RHAWTLKHFKKPTYCNFCHIMLMGVRKQGLCCIYCKYAVHQRCVSNSIPGC PHRFEPFNSLGAQWCAHCGFFLPLRRKDCFKCVECGITCHGQCAHLIPDYC DGKQ_HUMAN Human 0 GHSFRKVTLTKPTFCHLCSDFIWGLAGFLCDVCNFMSHEKCLKHVRIPC PHHFESHTNIGANWCCHCGYILPLGRKTARKCTECGITAHAQCVHLVPDFC GMIP_HUMAN Human 0 " FUNCTION: Stimulates, in vitro and in vivo, the GTPase activity of RhoA." THQLRRLRGPAKCRECEAFMVSGTECEECFLTCHKRCLETLLILC GMIP_MOUSE Mouse 0 " FUNCTION: Stimulates, in vitro and in vivo, the GTPase activity of RhoA (By similarity)." THRLRRLRGPAKCRECEAFMVSGTECEECFLTCHKRCLETLLILC GRP3_HUMAN Human 0 FUNCTION: Guanine nucleotide exchange factor (GEF) for Ras and Rap1. IHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLAC KPC1_ASPNG Others 0 GHKFVTQQFYNIMRCALCGDFLKYAAGMQCADCKYTCHKKCYPKVVTKC KPC1_CANAL Yeast 0 FUNCTION: Necessary for osmotic stability. GHQFVQKQFYNIMSCALCGEFLRYTGYQCQDCKFLCHKKCYQKVVTKC KPC1_COCHE Others 0 GHKFVQQQFYNVMRCALCAEFLKYAAGMQCSDCNYTCHKKCYPKVVTKC KPC1_NEUCR Others 0 GHKFVQKQFYNIMRCALCGDFLKYSAGMQCEDCKYTCHTKCYTSVVTKC KPC1_TRIRE Others 0 GHKFVQHQFYNIMPCALCGDFLKYSAGMQCEDCKYTCHNKCYPSVVTKC KPC1_YEAST Yeast 0 FUNCTION: Required for cell growth and for the G2->M transition of the cell division cycle. Mediates a protein kinase cascade; it activates BCK1 which itself activates MKK1/MKK2. GHHFVQKSFYNIMCCAYCGDFLRYTGFQCQDCKFLCHKKCYTNVVTKC KPC4_DROME Others 0 GHRFVAKFFRQPTFCAFCNLFLWGFGKQGYQCIICQTVVHKKCHDKLLGKC KRAF1_CAEEL Others 0 FUNCTION: Protein kinase that participates in the induction of C.elegans vulva. Acts downstream of the Ras protein let-60. KHAIVRRTFIPPKSCDVCNNPIWMMGFRCEFCQFKFHQRCSSFAPLYC KRAF1_DROME Others 0 FUNCTION: Serine/threonine kinase required in the early embryo for the formation of terminal structure. Also required during the proliferation of imaginal cells. May act downstream of ras1 in the sev signal transduction pathway. KHQIIRKTFFSLVFCEGCRRLLFTGFYCSQCNFRFHQRCANRVPMLC PCK1_SCHPO Yeast 0 FUNCTION: Involved in the control of the cell shape. Target of the inhibitor staurosporine. GHQFVQRQFYQIMRCAVCAELFSYSPGLQCENCSFVCHKKCVTKVLASC PCK2_SCHPO Yeast 0 FUNCTION: Involved in the control of the cell shape. Target of the inhibitor staurosporine. GHKFLQHQFYQIMRCALCGEFLKNAAGMQCIDCHYTCHKKCYPKVVTKC PDZK8_HUMAN Human 0 KHSFQDTQFQNPTWCDYCKKKVWTKAASQCMFCAYVCHKKCQEKCLAETSVC RAF1_CHICK Others 0 THNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMC RG84C_DROME Others 0 FUNCTION: Involved in the morphogenesis of the adult appendages. GTPase-activating protein for p21-Rac. Promotes the exchange of Rac-bound GDP by GTP. EHNFKIKSYYYNVGNCVHCRKRIRFAMASLRCRACPLRCHIGCCRQLTVNC RGA3_SCHPO Yeast 0 FUNCTION: GTPase-activating protein for Rho-type proteins (Potential). SUBCELLULAR LOCATION: Cell poles and septum. DHVFHVNAIFKPSRCYICSESVWGSELRCFHCSISCHSRCLKRLFAES RGNEF_MOUSE Mouse 0 " FUNCTION: Guanine nucleotide exchange factor that interacts with RHOA, but not with RAC or CDC42. Activates RHOA to promote cytoskeletal contraction and inhibit neurite outgrowth." RHQFVPGTFSGVLQCSGCDKTLLGKESLQCANCKANTHKGCKDAVPPC STAC3_HUMAN Human 0 PHKFKDHFFKKPKFCDVCARMIVLNNKFGLRCKNCKTNIHEHCQSYVEMQRC STAC3_MOUSE Mouse 0 PHKFKDHFFKKPKFCDVCARMIVLNNKFGLRCKNCKTNIHEHCQSYVEMQRC STAC3_XENTR Others 0 PHKFKDHYLKKPKFCDVCARMIVLNNKFGLRCKNCKTNIHHHCQSYVEFQKC VAV2_HUMAN Human 0 FUNCTION: Guanine nucleotide exchange factor for the Rho family of Ras-related GTPases. HHSFQMYTFDKTTNCKACKMFLRGTFYQGYMCTKCGVGAHKECLEVIPPC VAV2_MOUSE Mouse 0 FUNCTION: Guanine nucleotide exchange factor for the Rho family of Ras-related GTPases (By similarity). HHSFQMYTFDKTTNCKACKMFLRGTFYQGYLCTRCGVGAHKECLEVIPPC VAV3_HUMAN Human 0 " FUNCTION: Exchange factor for GTP-binding proteins RhoA, RhoG and, to a lesser extent, Rac1. Binds physically to the nucleotide-free states of those GTPases." FHDFKMHTFTRVTSCKVCQMLLRGTFYQGYLCFKCGARAHKECLGRVDNC VAV3_MOUSE Mouse 0 " FUNCTION: Exchange factor for GTP-binding proteins RhoA, RhoG and, to a lesser extent, Rac1. Binds physically to the nucleotide-free states of those GTPases (By similarity)." FHDFKMHTFTRVTSCRVCQMLLRGTFYQGYLCFKCGAKAHKECLGRVDNC VAV_CAEEL Others 0 " FUNCTION: Acts as guanine nucleotide exchange factor (GEF) for Rho GTPase. Has a critical roles in the generation of rhythmic behaviors: feeding, defecation and ovulation by dynamically regulating the concentration of intracellular calcium." NHKVAFHSFRVDVKNPATCDVCDKLMKGLQYQGYKCESCNMSMHKECLGLKKCEA VAV_DROME Others 0 FUNCTION: Couples tyrosine kinase signals with the activation of the Rho/Rac GTPases. Probably plays a pivotal role as a signal transducer protein during fruit fly development. DHKMEIYTFDAPTTCRHCSKFLKGRIHQGYRCKVCQISVHKGCISSTGRC VAV_HUMAN Human 0 " FUNCTION: Couples tyrosine kinase signals with the activation of the Rho/Rac GTPases, thus leading to cell differentiation and/or proliferation." GHDFQMFSFEETTSCKACQMLLRGTFYQGYRCHRCRASAHKECLGRVPPC VAV_MOUSE Mouse 0 " FUNCTION: Couples tyrosine kinase signals with the activation of the Rho/Rac GTPases, thus leading to cell differentiation and/or proliferation." GHDFQMFSFEETTSCKACQMLLRGTFYQGYRCYRCRAPAHKECLGRVPPC VAV_RAT Others 0 " FUNCTION: Couples tyrosine kinase signals with the activation of the Rho/Rac GTPases, thus leading to cell differentiation and/or proliferation." GHDFQMFSFEETTSCKACQMLLRGTFYQGYRCYRCRAPAHKECLGRVPPC YB65_SCHPO Yeast 0 FHDFKHVSFKLPTSCSYCREIIWGLSKRGCVCKNCGFKCHARCELLVPANC HHWVHRKLEKGKCKQCGKFFPMKQAVQSKLFGSKEIVALACAWCHEIYHNKEACFNQAKIGEEC DGKI_HUMAN Human 0 SUBCELLULAR LOCATION: Cytoplasm. Nucleus. HLWLETNVSGDLCYLGEENCQVRFAKSALRRKCAVCKIVVHTACIEQLEKINFRC HHWVHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVTCFMLHHIEEPC SNT2_SCHPO Yeast 0 SUBCELLULAR LOCATION: Nucleus (Probable). NYDFIVTEYGKGRALLNEPSNCKVCKKWCAFDFSVQCADCKKYYHMDCVVPPLLKK